DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL43 and MRPL51

DIOPT Version :9

Sequence 1:NP_523828.1 Gene:mRpL43 / 37750 FlyBaseID:FBgn0034893 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_015425.1 Gene:MRPL51 / 856214 SGDID:S000006304 Length:140 Species:Saccharomyces cerevisiae


Alignment Length:129 Identity:42/129 - (32%)
Similarity:64/129 - (49%) Gaps:21/129 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QNGLGRYVCQLQRITLKFCKNNGSSRGMRDFIENHLLD-FAKENPGIVVYVKPRRHRTPVLVGEY 81
            :||:|.:|...::|||:||...|||.|||.|:.:..|| :.:|.|.|...|. |:...|:|..||
Yeast    13 RNGVGAFVFPCRKITLQFCNWGGSSEGMRKFLTSKRLDKWGQEFPWIQFEVM-RKSGHPLLRAEY 76

  Fly    82 LNGEREWMSCRNSTQEEISKWIDLLK----------TQNGSSSSLRLRKMWHTEVPSIQGPWTP 135
            .||..:.:..||...:.:...:.|||          |:|.:..||.         .|::|.|:|
Yeast    77 TNGREKVICVRNLNIDNVENKLKLLKDSDGDILRRRTKNDNVESLN---------SSVRGIWSP 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL43NP_523828.1 L51_S25_CI-B8 40..109 CDD:197984 25/79 (32%)
MRPL51NP_015425.1 L51_S25_CI-B8 35..104 CDD:197984 25/69 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346321
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3445
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I1772
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004381
OrthoInspector 1 1.000 - - oto99375
orthoMCL 1 0.900 - - OOG6_103158
Panther 1 1.100 - - LDO PTHR21396
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1159
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.820

Return to query results.
Submit another query.