DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL43 and MRPL43

DIOPT Version :9

Sequence 1:NP_523828.1 Gene:mRpL43 / 37750 FlyBaseID:FBgn0034893 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001381910.1 Gene:MRPL43 / 84545 HGNCID:14517 Length:282 Species:Homo sapiens


Alignment Length:156 Identity:66/156 - (42%)
Similarity:93/156 - (59%) Gaps:14/156 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SGFPRAPLQNGLGRYVCQLQRITLKFCKNNGSSRGMRDFIENHLLDFAKENPGIVVYVKPRRHRT 74
            |.|..:.|.|||||||.||||::....::..||||.|:|:|..::|||:.|||:|:||..|....
Human     8 SRFLASVLHNGLGRYVQQLQRLSFSVSRDGASSRGAREFVEREVIDFARRNPGVVIYVNSRPCCV 72

  Fly    75 PVLVGEYLNG--EREWMSCRNSTQEEISKWIDLLKTQNGSSSSLRLRKMWHTEVPSIQGPWTPFL 137
            |.:|.|||||  ..|.:.|:  :.||||..:..|..|:| ...:|:||.:||:.|||||.|.||.
Human    73 PRVVAEYLNGAVREESIHCK--SVEEISTLVQKLADQSG-LDVIRIRKPFHTDNPSIQGQWHPFT 134

  Fly   138 --------LRSPDAQGQAYPSAEASK 155
                    ||..:.|..| |:.:|::
Human   135 NKPTTFRGLRPREVQDPA-PAQDAAE 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL43NP_523828.1 L51_S25_CI-B8 40..109 CDD:197984 31/70 (44%)
MRPL43NP_001381910.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159306
Domainoid 1 1.000 49 1.000 Domainoid score I11848
eggNOG 1 0.900 - - E1_KOG3445
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41847
Inparanoid 1 1.050 112 1.000 Inparanoid score I4865
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48937
OrthoDB 1 1.010 - - D1620056at2759
OrthoFinder 1 1.000 - - FOG0004381
OrthoInspector 1 1.000 - - oto89376
orthoMCL 1 0.900 - - OOG6_103158
Panther 1 1.100 - - LDO PTHR21396
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1159
SonicParanoid 1 1.000 - - X4758
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.800

Return to query results.
Submit another query.