DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL43 and AT3G59650

DIOPT Version :9

Sequence 1:NP_523828.1 Gene:mRpL43 / 37750 FlyBaseID:FBgn0034893 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001190137.1 Gene:AT3G59650 / 825134 AraportID:AT3G59650 Length:146 Species:Arabidopsis thaliana


Alignment Length:139 Identity:37/139 - (26%)
Similarity:61/139 - (43%) Gaps:28/139 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RYVCQLQRITLKFCKNNGSSRGMRDFIENHLLDFAKENPGIVVYVKPRRHRTPVLVG-------- 79
            |.|.||:::.:.:|...|||||:|.|:|:.|....::||.:.|..:..|.:.|.|.|        
plant     4 RGVWQLKKLVVSYCNWGGSSRGIRAFMESELPALKEKNPQLEVITELSRGQHPYLKGIYSMYISP 68

  Fly    80 ------------------EYLNGEREWMSC-RNSTQEEISKWIDLLKTQNGSSSSLRLRKMWHTE 125
                              :::....|.:.| :|...||:......|:...| ...::||....|:
plant    69 LLNTILIQRLLILAISLAQFIGNRNERVVCVKNMDPEEVLLNATRLRNSLG-RKVVKLRTRHVTK 132

  Fly   126 VPSIQGPWT 134
            .||:||.||
plant   133 HPSVQGTWT 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL43NP_523828.1 L51_S25_CI-B8 40..109 CDD:197984 22/95 (23%)
AT3G59650NP_001190137.1 L51_S25_CI-B8 21..117 CDD:197984 22/95 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3445
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I2654
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1620056at2759
OrthoFinder 1 1.000 - - FOG0004381
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103158
Panther 1 1.100 - - LDO PTHR21396
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.