DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment angel and NGL1

DIOPT Version :9

Sequence 1:NP_477204.1 Gene:angel / 37748 FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_014600.1 Gene:NGL1 / 854115 SGDID:S000005402 Length:363 Species:Saccharomyces cerevisiae


Alignment Length:380 Identity:90/380 - (23%)
Similarity:137/380 - (36%) Gaps:118/380 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 GRDPHKCSSFKVVSYNILAQDLLLEHLFLYVGIPHEFLSWQRRQQNLLRELLK-LDPDILCLQEM 122
            |:...|.:.|.:::||:|:...:...::.||..|::  :|..|.:.|.:|||. ...||:|||||
Yeast    18 GKYVRKDARFTLLTYNMLSPSYMWPQVYTYVAEPYK--NWSYRHRLLEKELLNTFKADIMCLQEM 80

  Fly   123 -------------------------------------------------QFDHLP----VLVQRL 134
                                                             :||.:.    .|.|.|
Yeast    81 TARDYEDYWHDSIGVDVNYGSKFISKTPPKYWKKPVKDMDGVSIFYNLAKFDFISSSGIYLNQLL 145

  Fly   135 RMGNGKKLAYVYKKKTGCRTDGCAIVYDSSKFELLDHQAVELYDQAVALLNRDNVALFARFRFKK 199
            .:.|.::|.|:|.||. ..|||.:.|....  .|||           .|..::.|.||...|.| 
Yeast   146 NVFNQRELKYLYNKKV-TLTDGASNVIGED--SLLD-----------VLKGKNQVCLFVSLRHK- 195

  Fly   200 QQEQQKEFVVATTHLLFNTKRSDVRCAQVERILEELQSF-----------STDTPIVLTGDFNSL 253
              |....|||..|||.:  |..:|:..|...|:.||...           .....|:.|||.||.
Yeast   196 --ETGTIFVVLNTHLYW--KYDEVKLTQCMIIMRELSKIIKQLLPGDVKGQERVKILFTGDLNST 256

  Fly   254 PDSSPIEFLVGK---NGDVD--------STAC-----PEPLHFEIIDSGEGTASTYQNEWV-IVD 301
            .||..:.||.|:   :||::        ...|     |:........||: ....:...|. ..|
Yeast   257 RDSLVVNFLQGQIVSHGDLNLINPMRPYLDRCVYDDIPKDYFVHTCYSGK-LKGIFDYVWYHDSD 320

  Fly   302 YILRSL--GSRSRHKLLPLSVYSLPSINRCIGAGQIPNYRLGSDHYALGAVFTVV 354
            ::|..:  |:....:||..:...||:.|.            .|||..|...|.::
Yeast   321 FLLTKILTGNEVSDELLASNQLGLPNENH------------PSDHIPLLTEFKIL 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 86/364 (24%)
NGL1NP_014600.1 CCR4 1..363 CDD:227564 90/378 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.