DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment angel and AT5G54130

DIOPT Version :9

Sequence 1:NP_477204.1 Gene:angel / 37748 FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001078754.1 Gene:AT5G54130 / 835500 AraportID:AT5G54130 Length:436 Species:Arabidopsis thaliana


Alignment Length:315 Identity:76/315 - (24%)
Similarity:129/315 - (40%) Gaps:83/315 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 RWTSLGNQAEG---RDPHKCSSFKVVSYNILAQDLLLEHLFLYVGIPHEFLS---------WQRR 101
            |.:.:|:.|..   ||.|:.......::||||.        :|..:.|:..|         |..|
plant     4 RISKIGSYAISSSIRDQHQQPCISCTTFNILAP--------IYKRLSHKDQSLRESDNRAYWLGR 60

  Fly   102 QQNLLRELLKLDPDILCLQEMQF--DHLPVLVQRLRMGNGKKLAYVYKKKTGCRTDGCAIVYDSS 164
            ...::..||.....|:||||...  :.|..|.:: |:|:...|:|.. .:|..|.||........
plant    61 NHRIIDWLLYERSSIICLQEFWVGNEELVNLYEK-RLGDAGYLSYKL-GRTNNRGDGLLTAVHKD 123

  Fly   165 KFELLDHQAV---ELYDQAVALLNRDNVALFARFRFKKQQEQQKEFVVATTHLLF--NTKRSDVR 224
            .|.:::.:.:   :..|:...||:.:.|..::      |.:..:|.::..|||||  ::..|.||
plant   124 YFRVVNSRDLLFNDCGDRVAQLLHVELVPPYS------QYDAHQEVLIVNTHLLFPHDSTLSIVR 182

  Fly   225 CAQVERILEELQSFSTDT-----PIVLTGDFNSLPDSSPIEFLVGKNGDVDSTACPEPLHFEIID 284
            ..||.:||:.::|:..:.     ||:|.||:|.           .|.|.|          ::.:.
plant   183 LQQVYKILQYVESYQKEVNLSPMPIILCGDWNG-----------SKRGHV----------YKFLR 226

  Fly   285 SGEGTASTYQ----------NEWV----------IVDYILRSLGSRSRHKLLPLS 319
            | :|..|:|.          ::||          .||:|.....:|.| |||..|
plant   227 S-QGFVSSYDTAHRYTDSDAHKWVSHRNHRGNICAVDFIWLLNPNRYR-KLLKTS 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 70/291 (24%)
AT5G54130NP_001078754.1 EEP 32..>247 CDD:412407 59/252 (23%)
EFh 299..365 CDD:415501
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12121
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.