DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment angel and LRRC27

DIOPT Version :9

Sequence 1:	NP_477204.1	Gene:	angel / 37748	FlyBaseID:	FBgn0016762	Length:	354	Species:	Drosophila melanogaster
Sequence 2:	NP_001137229.1	Gene:	LRRC27 / 80313	HGNCID:	29346	Length:	530	Species:	Homo sapiens

Alignment Length:	108	Identity:	24/108 - (22%)
Similarity:	41/108 - (37%)	Gaps:	22/108 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly   253 LPDSSPIEFLVGKNGDVDSTA------CPEPLHFE---IIDSGEGTASTYQNEWVIVDYILRSLG 308
            |.:.:||:.|..:.|.|.:..      |  ||.|.   ::..|......:...|.:...:.|:..
Human   120 LLERNPIKMLPVELGSVTTLKALNLRHC--PLEFPPQLVVQKGLVAIQRFLRMWAVEHSLPRNPT 182

  Fly   309 SRSRHKLLPLSVYSLPSINRCIGAGQIPNYRLGSDHYA-LGAV 350
            |:....:..:::..|||          |...|..||.: .|||
Human   183 SQEAPPVREMTLRDLPS----------PGLELSGDHASNQGAV 215

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
angel	NP_477204.1	EEP	70..351	CDD:294334	24/108 (22%)
LRRC27	NP_001137229.1	LRR 1	46..67
		leucine-rich repeat	49..68	CDD:275378
		LRR_8	67..126	CDD:290566	1/5 (20%)
		LRR_4	67..108	CDD:289563
		LRR 2	68..89
		leucine-rich repeat	69..92	CDD:275378
		LRR_4	91..127	CDD:289563	2/6 (33%)
		LRR 3	92..113
		leucine-rich repeat	93..115	CDD:275378
		LRR 4	115..136		5/15 (33%)
		leucine-rich repeat	116..138	CDD:275378	6/17 (35%)
		LRR 5	138..159		4/22 (18%)
		leucine-rich repeat	139..150	CDD:275378	2/12 (17%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	178..215		10/46 (22%)
		DUF3629	<331..471	CDD:289102
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	402..432
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5239
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900