DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment angel and Angel1

DIOPT Version :9

Sequence 1:NP_477204.1 Gene:angel / 37748 FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_011242471.1 Gene:Angel1 / 68737 MGIID:1915987 Length:690 Species:Mus musculus


Alignment Length:244 Identity:91/244 - (37%)
Similarity:126/244 - (51%) Gaps:23/244 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 RRWTSLGNQAE------GRDPHKCSSFKVVSYNILAQDLLLEHLFLYVGIPHEFLSWQRRQQNLL 106
            |.|.....|.:      |..|.  ..|.::|||||||||:.:...||:....:.|:|..|..||:
Mouse   241 REWEDFSTQPDAQGLEAGDGPQ--FQFTLMSYNILAQDLMQQSSELYLHCHPDILNWNYRFANLM 303

  Fly   107 RELLKLDPDILCLQEMQFDHL-PVLVQRLRMGNGKKLAYVYKKKTGCRTDGCAIVYDSSKFELLD 170
            :|....|||||||||:|.||. ..|...|||   ......||::|||:|||||:.|..::|.||.
Mouse   304 QEFQHWDPDILCLQEVQEDHYWEQLEPSLRM---MGFTCFYKRRTGCKTDGCAVCYKPTRFRLLC 365

  Fly   171 HQAVELYDQAVALLNRDNVALFARFR----FKKQQEQQKEFVVATTHLLFNTKRSDVRCAQVERI 231
            ...||.:...:.|||||||.|....:    ....|.......||.||:|:|.:|.||:.||:..:
Mouse   366 ASPVEYFRPGLELLNRDNVGLVLLLQPLVPEGLGQVSVAPLCVANTHVLYNPRRGDVKLAQMAIL 430

  Fly   232 LEELQ-----SFSTDTPIVLTGDFNSLPDSSPIEFLVGKNGDVDSTACP 275
            |.|:.     |..:..||:|.||.||:|||....|:  ::|::.....|
Mouse   431 LAEVDKVARLSDGSHCPIILCGDLNSVPDSPLYNFI--RDGELQYNGMP 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 85/216 (39%)
Angel1XP_011242471.1 EEP 268..683 CDD:382041 85/215 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833978
Domainoid 1 1.000 136 1.000 Domainoid score I4910
eggNOG 1 0.900 - - E1_COG5239
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32251
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D395901at33208
OrthoFinder 1 1.000 - - FOG0002618
OrthoInspector 1 1.000 - - otm42397
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12121
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3577
SonicParanoid 1 1.000 - - X1517
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.