DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment angel and CNOT6

DIOPT Version :10

Sequence 1:NP_477204.1 Gene:angel / 37748 FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001357401.1 Gene:CNOT6 / 57472 HGNCID:14099 Length:557 Species:Homo sapiens


Alignment Length:424 Identity:104/424 - (24%)
Similarity:167/424 - (39%) Gaps:127/424 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RRSVSSQAKGASGKRKQKAKEMESSHDRNRRWTSLGNQAEGRDPHK---CSSFKVVSYNILAQDL 80
            ||.::......||    .||.:.:.....|.|..|      ::|.:   .:.|.|:.||:|....
Human   147 RRLLNYLLDNLSG----TAKRITTEQPPPRSWIML------QEPDRTRPTALFSVMCYNVLCDKY 201

  Fly    81 LLEHLFLYVGIPHEFLSWQRRQQNLLRELLKLDPDILCLQEMQFD--HLPVLVQRLRMG-NGKKL 142
            ....|:.|  .|...|:|..|::.:::|:|..:.||:.|||::.:  :...||:....| ||   
Human   202 ATRQLYGY--CPSWALNWDYRKKAIIQEILSCNADIVSLQEVETEQYYSFFLVELKERGYNG--- 261

  Fly   143 AYVYKKKTGCRT---------DGCAIVYDSSKFELLDHQAVELYDQAV-------ALLNR----D 187
              .:..|:..||         |||||.:.:.||.|:....||....|:       |:|||    |
Human   262 --FFSPKSRARTMSEQERKHVDGCAIFFKTEKFTLVQKHTVEFNQLAMANSEGSEAMLNRVMTKD 324

  Fly   188 NVALFARFRFKKQQEQ----------QKEFV-VATTHLLFNTKRSDVRCAQVERILEELQS---- 237
            |:.:......:|:..:          :|:.: ||..|:.::.:.|||:..|....|.|:::    
Human   325 NIGVAVLLELRKESIEMPSGKPHLGTEKQLILVANAHMHWDPEYSDVKLVQTMMFLSEVKNIIDK 389

  Fly   238 ------------FSTDTPIVLTGDFNSLPDSSPIEFLV--------------------------G 264
                        |.| .|:||..|.||||||..:|:|.                          |
Human   390 ASRNLKSSVLGEFGT-IPLVLCADLNSLPDSGVVEYLSTGGVETNHKDFKELRYNESLTNFSCHG 453

  Fly   265 KNGDVDSTACPEPLH-FEIIDSGEGTASTYQNEWV----IVDYILRS---------LGSRSRHKL 315
            |||..:...    .| |::..:.|.....|.|...    |:|||..|         ||....|.|
Human   454 KNGTTNGRI----THGFKLQSAYESGLMPYTNYTFDFKGIIDYIFYSKPQLNTLGILGPLDHHWL 514

  Fly   316 LPLSVYSLPSINRCIGAGQIPNYRLGSDHYALGA 349
            :.      .:|:.|      |:..:.|||::|.|
Human   515 VE------NNISGC------PHPLIPSDHFSLFA 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:469791 93/370 (25%)
CNOT6NP_001357401.1 LRR <33..>133 CDD:443914
leucine-rich repeat 33..52 CDD:275378
LRR 1 52..73
leucine-rich repeat 53..75 CDD:275378
LRR 2 75..96
leucine-rich repeat 76..98 CDD:275378
LRR 3 98..120
leucine-rich repeat 99..121 CDD:275378
LRR 4 121..143
leucine-rich repeat 122..133 CDD:275378
Nuclease domain. /evidence=ECO:0000250 153..557 102/418 (24%)
Deadenylase_CCR4a 191..540 CDD:197340 93/370 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.