DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment angel and nocta

DIOPT Version :9

Sequence 1:NP_477204.1 Gene:angel / 37748 FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_700794.1 Gene:nocta / 572044 ZFINID:ZDB-GENE-050208-306 Length:432 Species:Danio rerio


Alignment Length:316 Identity:83/316 - (26%)
Similarity:136/316 - (43%) Gaps:62/316 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 SSFKVVSYNILAQDLLLEHLFLYVGIPHEFLSWQRRQQNLLRELLKLDPDILCLQEMQFDHLPVL 130
            |..:::.:||||| .|.|....:|..|.|.|:|..|:..:|.|:|...||::||||:  ||....
Zfish   131 SPLRIMQWNILAQ-ALGEGKDGFVRCPMEALNWSERKYLILEEILTYRPDVVCLQEV--DHYFDT 192

  Fly   131 VQRLRMGNGKKLAYVYKKKTGC-------RTDGCAIVYDSSKFELLDHQAVELYDQAVALLNRDN 188
            .|.:....|.:.::..|..:.|       ..||||:.::..:|::|....:.|   :..:|..:.
Zfish   193 FQPVLSSLGYQSSFCPKPCSPCLDVHNNNGPDGCALFFNRRRFQMLHTAHLRL---SAMMLKTNQ 254

  Fly   189 VALFARFRFKKQQEQQKEFVVATTHLLFNTKRSDVRCAQVERILEELQSFSTDT----------- 242
            ||:.|..|.|.   ..:.|.||.|||...:.....|.||...:|::|...::.:           
Zfish   255 VAVVATLRCKL---TGRVFCVAVTHLKARSGWEAFRSAQGANLLQQLHEITSQSNPEMHQDDQTE 316

  Fly   243 --PIVLTGDFNSLPDSSPIEFLVGKNGDVDS---------TACPEPLHFEIIDSGEGTASTYQNE 296
              |:::.||||:.|:..........:..:||         |..|....::|..||| ..||....
Zfish   317 GIPLIVCGDFNAEPNEEVYRHFRSSSLGLDSVYKCLSDDRTTEPPYTSWKIRPSGE-CCSTLDYI 380

  Fly   297 WVI-----VDYILRSLGSRSRHKLLPLSVYSLPSINRCIGAGQIPNYRLGSDHYAL 347
            |..     ||.:||                 :||..: ||..::|::...|||.:|
Zfish   381 WYSEKAFEVDAVLR-----------------IPSEEQ-IGPDRLPSFHYPSDHLSL 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 82/312 (26%)
noctaXP_700794.1 Deadenylase_nocturnin 134..424 CDD:197330 82/313 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.