DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment angel and angel1

DIOPT Version :9

Sequence 1:NP_477204.1 Gene:angel / 37748 FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_021328890.1 Gene:angel1 / 569547 ZFINID:ZDB-GENE-111020-12 Length:667 Species:Danio rerio


Alignment Length:302 Identity:97/302 - (32%)
Similarity:140/302 - (46%) Gaps:54/302 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 RRWTSLG--NQAEGRDPHKCSSFKVVSYNILAQDLLLEHLFLYVGIPHEFLSWQRRQQNLLRELL 110
            |.|..|.  ..::..|......|.|:||||||||||..:..||.....:.|.|:.|.|.:|:||.
Zfish   238 RVWEDLSEPQSSDSADASPVFDFSVMSYNILAQDLLEANPHLYTHCAEDALRWENRLQAVLKELQ 302

  Fly   111 KLDPDILCLQEMQFDHL-----PVLVQRLRMGNGKKLAYVYKKKTGCRTDGCAIVYDSSKFELLD 170
            ...|||:||||:|.||.     |||:   .||    ...:||::||.:|||||::|...:|..|.
Zfish   303 IWQPDIVCLQEVQEDHFQEQMHPVLI---NMG----YTCIYKRRTGSKTDGCAVLYRGERFTQLS 360

  Fly   171 HQAVELYDQAVALLNRDNVALFARFR-FKKQQEQQKEFVVATTHLLFNTKRSDVRCAQ------- 227
            ...:|.......||:||||.:....: ......|.....||.||||||.:|.||:.||       
Zfish   361 VSLLEFRRSECELLDRDNVGIVLLLQPTAGPHHQFTPVCVANTHLLFNPRRGDVKLAQLAIMFAE 425

  Fly   228 VERILEELQSFSTDTPIVLTGDFNSLPDSSPIEFLVGKNGDVDSTACPEPLHFEIIDSGEGTAST 292
            :..::::.:|......::|.||||::|.|                    || :.:|.:||    .
Zfish   426 IHSVMQKCRSEGKSCELILCGDFNAVPRS--------------------PL-WTLITTGE----L 465

  Fly   293 YQN---EWVIVDYILRSLGSRSRHKLL--PLSVYSLPSINRC 329
            |.:   .|::...  ..|..::.|..|  ||...||...:||
Zfish   466 YYHGLPTWMVSGQ--TDLSYKAHHNRLFSPLWPSSLGITDRC 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 92/278 (33%)
angel1XP_021328890.1 EEP 262..662 CDD:321002 92/278 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576693
Domainoid 1 1.000 129 1.000 Domainoid score I5222
eggNOG 1 0.900 - - E1_COG5239
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D395901at33208
OrthoFinder 1 1.000 - - FOG0002618
OrthoInspector 1 1.000 - - otm25767
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12121
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3577
SonicParanoid 1 1.000 - - X1517
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.