DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment angel and cnot6b

DIOPT Version :9

Sequence 1:NP_477204.1 Gene:angel / 37748 FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001103498.1 Gene:cnot6b / 560386 ZFINID:ZDB-GENE-071004-97 Length:558 Species:Danio rerio


Alignment Length:407 Identity:98/407 - (24%)
Similarity:155/407 - (38%) Gaps:116/407 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KEMESSHDRNRRWTSLGNQAEGRDPHKCSSFKVVSYNILAQDLLLEHLFLYVGIPHEFLSWQRRQ 102
            |.:.:.....|.|..|......|   ..:...|:.||:|........|:.|  .|...|:|..|:
Zfish   162 KRIPTEQPPPRSWIVLQEPERSR---PTALLTVMCYNVLCDKYATRQLYGY--CPSWALNWSYRK 221

  Fly   103 QNLLRELLKLDPDILCLQEMQ----FDHLPVLVQRLRMG-----NGKKLAYVYKKKTGCRTDGCA 158
            :::::|:|..:.||:.|||::    ||..  |::..:.|     :.|..|....:......||||
Zfish   222 KSIMQEILNCNADIISLQEVETEQYFDFF--LLELSKQGYDGFFSPKSRARTMSESDRKHVDGCA 284

  Fly   159 IVYDSSKFELLDHQAVELYDQAV-------ALLNR----DNVALFARFRFKKQ------------ 200
            |.|.:.||.::....||....|:       |:|||    ||:.:......||:            
Zfish   285 IFYKTEKFNVVQKHTVEFNQLAMANSEGSEAMLNRVMTKDNIGVAVLLELKKELIEVSSGKSIHP 349

  Fly   201 QEQQKEFVVATTHLLFNTKRSDVRCAQVERILEELQ-------------SFSTDT---PIVLTGD 249
            .|:|. .:||..|:.::.:.|||:..|....|.|::             |.|.:|   |:||..|
Zfish   350 MEKQL-LLVANAHMHWDPEYSDVKLVQTMMFLSEVKNIIDKASRSLKHSSVSGETSSIPLVLCAD 413

  Fly   250 FNSLPDSSPIEFLVGKNGDVD------------------------STACPEPLH-FEIIDSGEGT 289
            .||||||..:|:|  ..|.||                        ||:.....| |::..:.|..
Zfish   414 LNSLPDSGVVEYL--STGGVDCTHKDFKELRYSDSLTNFNCNGKNSTSNGRITHAFKLKSAYENG 476

  Fly   290 ASTYQNEWV----IVDYILRSLGSRSRHKLLPLSVYSLPSINRCIGAGQI-------------PN 337
            ...|.|...    ::|||.                ||.|.:|.....|.:             |:
Zfish   477 LMPYTNYTFDFRGVIDYIF----------------YSRPQLNVLGVLGPLDTNWLLENNISGCPH 525

  Fly   338 YRLGSDHYALGAVFTVV 354
            ..:.|||::|.|...:|
Zfish   526 PLIPSDHFSLFAQLELV 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 92/370 (25%)
cnot6bNP_001103498.1 LRR_8 51..109 CDD:290566
LRR_4 51..91 CDD:289563
leucine-rich repeat 53..75 CDD:275380
LRR_4 75..113 CDD:289563
leucine-rich repeat 76..98 CDD:275380
leucine-rich repeat 99..121 CDD:275380
Deadenylase_CCR4a 191..541 CDD:197340 92/372 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576691
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.