DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment angel and angel1

DIOPT Version :9

Sequence 1:NP_477204.1 Gene:angel / 37748 FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_031746304.1 Gene:angel1 / 548990 XenbaseID:XB-GENE-6454204 Length:603 Species:Xenopus tropicalis


Alignment Length:254 Identity:87/254 - (34%)
Similarity:124/254 - (48%) Gaps:27/254 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KQKAKEMESSH--DRNRR-----------WTSLGNQAEGRD-PHKCSSFKVVSYNILAQDLLLEH 84
            |:|..|.:|.|  |..:.           |....|..|..| ..|...|.|:|||||:|||..::
 Frog   128 KEKPSEEDSWHLLDLEQSLPQPAMYSEFLWRDWENLCETEDISDKQFDFSVLSYNILSQDLADQN 192

  Fly    85 LFLYVGIPHEFLSWQRRQQNLLRELLKLDPDILCLQEMQFDHLPVLVQRLRMGNGKKLAYVYKKK 149
            ..||.......|.|..|..|:|:||...:.||:||||:|.||....|:......|  .:..:|::
 Frog   193 PELYQHCDPSILHWDYRWPNILQELQHWEADIICLQEVQQDHYKEHVEPSLSAIG--YSCHFKRR 255

  Fly   150 TGCRTDGCAIVYDSSKFELLDHQAVELYDQAVALLNRDNVALFARFRFKKQQEQQKE-----FVV 209
            ||.:||||...|.:.:|.||....||.:...:.:||||||.|....:......||..     ..|
 Frog   256 TGRKTDGCCTCYKTQRFMLLSESHVEFFRPGIDVLNRDNVGLVLLLKPLLPDAQQGRHNPIPLCV 320

  Fly   210 ATTHLLFNTKRSDVRCAQVERILEELQSFS-----TDTPIVLTGDFNSLPDSSPIEFLV 263
            |.||||:|.:|.|::.||:..:|.|:...|     :..|::|.||.|:.|| ||:..|:
 Frog   321 ANTHLLYNPRRGDIKLAQLALLLAEVDKISLTAHGSHYPVILCGDLNATPD-SPLYHLL 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 75/204 (37%)
angel1XP_031746304.1 EEP 178..>378 CDD:412407 74/202 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I5026
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H32251
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D395901at33208
OrthoFinder 1 1.000 - - FOG0002618
OrthoInspector 1 1.000 - - otm47505
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1517
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.010

Return to query results.
Submit another query.