DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment angel and Angel2

DIOPT Version :9

Sequence 1:NP_477204.1 Gene:angel / 37748 FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_067396.3 Gene:Angel2 / 52477 MGIID:1196310 Length:544 Species:Mus musculus


Alignment Length:390 Identity:112/390 - (28%)
Similarity:165/390 - (42%) Gaps:85/390 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LHNVSLKATSRIIRRS-----VSSQAKGAS----------GKRKQKAKEMESSHDRNRRWTSLGN 55
            |.|.||...||.:..|     :|.:.|...          ...|:..|::|   |||     :.:
Mouse   100 LSNASLIHLSRHVMTSDRDEPLSKRRKHQGTIKRNWEYLCSHNKENTKDLE---DRN-----VDS 156

  Fly    56 QAEGRDPHKCSSFKVVSYNILAQDLLLEHLFLYVGIPHEFLSWQRRQQNLLRELLKLDPDILCLQ 120
            ..|.|:..  ..|.|:|||||:||||.::..||.......|.|..|..|:|:|:...|.|:||||
Mouse   157 TCEDREDK--FDFSVMSYNILSQDLLEDNSHLYRHCRRPVLHWSFRFPNILKEIKHFDADVLCLQ 219

  Fly   121 EMQFDHL-----PVLVQRLRMGNGKKLAY--VYKKKTGCRTDGCAIVYDSSKFELLDHQAVELYD 178
            |:|.||.     |.|         :.|.|  .||.|||.:.|||||.:..|:|.||....||...
Mouse   220 EVQEDHYGTEIRPSL---------ESLGYHCEYKMKTGRKPDGCAICFKHSRFSLLSVNPVEFCR 275

  Fly   179 QAVALLNRDNVALFARFRFKKQQEQQKEFVVATTHLLFNTKRSDVRCAQVERILEELQSFS---- 239
            :.:.||:|||:.|....:.|..:.......:|.||||:|.:|.|::..|:..:|.|:.:.:    
Mouse   276 RDIPLLDRDNIGLVLLLQPKIPRAASPSICIANTHLLYNPRRGDIKLTQLAMLLAEIANVTHRKD 340

  Fly   240 -TDTPIVLTGDFNSLPDSSPIEFL-----------VGK-NGDVDSTACPEPLHFEI--------- 282
             :..|||:.|||||:|.|....|:           :|| :|...|:.....|...|         
Mouse   341 GSSCPIVMCGDFNSVPGSPLYSFIKEGKLNYEGLAIGKVSGQEQSSRGQRILSIPIWPPNLGISQ 405

  Fly   283 -----------IDSGEGTASTYQNEWVIVDYILRSLGSRSRHKLLPLSVYS-------LPSINRC 329
                       ::..:...:..|.|...|......:.|..:|.....||||       :|.:..|
Mouse   406 NCVYEAQQVPKVEKTDSDVTQAQQEKAEVPVSADKVSSHLQHGFSLSSVYSHYVPDTGVPEVTTC 470

  Fly   330  329
            Mouse   471  470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 94/311 (30%)
Angel2NP_067396.3 EEP 169..542 CDD:294334 94/311 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833976
Domainoid 1 1.000 136 1.000 Domainoid score I4910
eggNOG 1 0.900 - - E1_COG5239
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002618
OrthoInspector 1 1.000 - - otm42397
orthoMCL 1 0.900 - - OOG6_105310
Panther 1 1.100 - - O PTHR12121
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3577
SonicParanoid 1 1.000 - - X1517
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.730

Return to query results.
Submit another query.