DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment angel and twin

DIOPT Version :10

Sequence 1:NP_477204.1 Gene:angel / 37748 FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_732964.1 Gene:twin / 42880 FlyBaseID:FBgn0011725 Length:567 Species:Drosophila melanogaster


Alignment Length:383 Identity:100/383 - (26%)
Similarity:156/383 - (40%) Gaps:111/383 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 RRWTSLGNQAEGRDPHK---CSSFKVVSYNILAQDLLLEHLFLYVGIPHEFLSWQRRQQNLLREL 109
            |.|..|..      |:|   ...|.|:.||:|........::.|  .|...|.|:.|:::::.|:
  Fly   190 RPWLPLAK------PNKTRPACIFTVMCYNVLCDKYATRQMYGY--CPSWALCWEYRKKSIIDEI 246

  Fly   110 LKLDPDILCLQEM---QFDH--LPVLVQRLRMGNGKKLAY--VYKKKTGCRT---------DGCA 158
            .....||:.|||:   ||.|  ||.|         |...|  ::..|:..:|         ||||
  Fly   247 RHYAADIISLQEIETEQFYHFFLPEL---------KNDGYEGIFSPKSRAKTMSELERKYVDGCA 302

  Fly   159 IVYDSSKFELLDHQAVELYDQAVA-------LLNR----DNVALFARFRFKKQQ-EQQKE----- 206
            |.:.:|||.|:....:|....|:|       :|||    ||:.|.|..:.|:.. |...|     
  Fly   303 IFFRASKFTLIKESLIEFNQLAMANAEGSDNMLNRVMPKDNIGLAALLKVKENAWEPMSEVTQIS 367

  Fly   207 --FVVATTHLLFNTKRSDVRCAQVERILEELQSF---------------STDTPIVLTGDFNSLP 254
              .:|.|.|:.::.:..||:..|...:..||::.               |....::|.|||||||
  Fly   368 QPLLVCTAHIHWDPEFCDVKLIQTMMLSNELKTIIDEASHSFRPGHKNDSNAVQLLLCGDFNSLP 432

  Fly   255 DSSPIEFLVGKN---------GDVDSTACPEPLHFEIIDSGEGT-----ASTYQNEWV------- 298
            ||..:||| ||.         .|:...:|.:.|...  |:.|.|     ||.|..:.:       
  Fly   433 DSGVVEFL-GKGRVSMDHLDFKDMGYKSCLQRLLSN--DTNEFTHSFKLASAYNEDIMPHTNYTF 494

  Fly   299 ----IVDYILRSLGSRSRHKLLPLSVYSLPS-----INRCIGAGQIPNYRLGSDHYAL 347
                |:|||.     .::..::||.:....|     .|:.:|.   |:..:.|||:.|
  Fly   495 DFKGIIDYIF-----YTKTGMVPLGLLGPVSNDWLRENKVVGC---PHPHIPSDHFPL 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:469791 94/358 (26%)
twinNP_732964.1 LRR <52..>155 CDD:443914
leucine-rich repeat 76..98 CDD:275378
leucine-rich repeat 99..121 CDD:275378
leucine-rich repeat 122..144 CDD:275378
leucine-rich repeat 145..156 CDD:275378
Deadenylase_CCR4 209..550 CDD:197331 94/358 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.