DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment angel and twin

DIOPT Version :9

Sequence 1:NP_477204.1 Gene:angel / 37748 FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_732964.1 Gene:twin / 42880 FlyBaseID:FBgn0011725 Length:567 Species:Drosophila melanogaster


Alignment Length:383 Identity:100/383 - (26%)
Similarity:156/383 - (40%) Gaps:111/383 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 RRWTSLGNQAEGRDPHK---CSSFKVVSYNILAQDLLLEHLFLYVGIPHEFLSWQRRQQNLLREL 109
            |.|..|..      |:|   ...|.|:.||:|........::.|  .|...|.|:.|:::::.|:
  Fly   190 RPWLPLAK------PNKTRPACIFTVMCYNVLCDKYATRQMYGY--CPSWALCWEYRKKSIIDEI 246

  Fly   110 LKLDPDILCLQEM---QFDH--LPVLVQRLRMGNGKKLAY--VYKKKTGCRT---------DGCA 158
            .....||:.|||:   ||.|  ||.|         |...|  ::..|:..:|         ||||
  Fly   247 RHYAADIISLQEIETEQFYHFFLPEL---------KNDGYEGIFSPKSRAKTMSELERKYVDGCA 302

  Fly   159 IVYDSSKFELLDHQAVELYDQAVA-------LLNR----DNVALFARFRFKKQQ-EQQKE----- 206
            |.:.:|||.|:....:|....|:|       :|||    ||:.|.|..:.|:.. |...|     
  Fly   303 IFFRASKFTLIKESLIEFNQLAMANAEGSDNMLNRVMPKDNIGLAALLKVKENAWEPMSEVTQIS 367

  Fly   207 --FVVATTHLLFNTKRSDVRCAQVERILEELQSF---------------STDTPIVLTGDFNSLP 254
              .:|.|.|:.::.:..||:..|...:..||::.               |....::|.|||||||
  Fly   368 QPLLVCTAHIHWDPEFCDVKLIQTMMLSNELKTIIDEASHSFRPGHKNDSNAVQLLLCGDFNSLP 432

  Fly   255 DSSPIEFLVGKN---------GDVDSTACPEPLHFEIIDSGEGT-----ASTYQNEWV------- 298
            ||..:||| ||.         .|:...:|.:.|...  |:.|.|     ||.|..:.:       
  Fly   433 DSGVVEFL-GKGRVSMDHLDFKDMGYKSCLQRLLSN--DTNEFTHSFKLASAYNEDIMPHTNYTF 494

  Fly   299 ----IVDYILRSLGSRSRHKLLPLSVYSLPS-----INRCIGAGQIPNYRLGSDHYAL 347
                |:|||.     .::..::||.:....|     .|:.:|.   |:..:.|||:.|
  Fly   495 DFKGIIDYIF-----YTKTGMVPLGLLGPVSNDWLRENKVVGC---PHPHIPSDHFPL 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 94/358 (26%)
twinNP_732964.1 LRR_4 74..114 CDD:289563
LRR_8 75..130 CDD:290566
leucine-rich repeat 76..98 CDD:275378
LRR_4 97..136 CDD:289563
leucine-rich repeat 99..121 CDD:275378
leucine-rich repeat 122..144 CDD:275378
leucine-rich repeat 145..156 CDD:275378
Deadenylase_CCR4 209..550 CDD:197331 94/358 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443969
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5239
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12121
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.