DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment angel and cu

DIOPT Version :9

Sequence 1:NP_477204.1 Gene:angel / 37748 FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001097746.1 Gene:cu / 41339 FlyBaseID:FBgn0261808 Length:642 Species:Drosophila melanogaster


Alignment Length:339 Identity:89/339 - (26%)
Similarity:146/339 - (43%) Gaps:77/339 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 EGRDPHKCSSFKVVSYNILAQDLLLEHLFLYVGIPHEFLSWQRRQQNLLRELLKLDPDILCLQEM 122
            ||.|      .:::.:|||:| .|.:|...:|..|.|.|:|:.|:..:::|:|:..||::||||:
  Fly   307 EGDD------IRLLQWNILSQ-TLGQHNDGFVRCPEEALTWEHRKYLIVQEILQNQPDVICLQEV 364

  Fly   123 QFDHLPVLVQRLRMGNGKKLAYVYKKKTGC-------RTDGCAIVYDSSKFEL--LDHQAVELYD 178
              ||...|...|...|...: :..|..:.|       ..|||||.|...|.:|  .|.:.:|:: 
  Fly   365 --DHFKFLQTVLGSQNYAGI-FFPKPDSPCLYIEQNNGPDGCAIFYKRDKLQLQGYDTRILEVW- 425

  Fly   179 QAVALLNRDNVALFARFRFKKQQEQQKEFVVATTHL--LFNTKRSDVRCAQVERILEELQSFSTD 241
                .:..:.||:.||.|.:   ...:||.||||||  ......:.:|..|...::..::.|:.|
  Fly   426 ----RVQSNQVAIAARLRMR---SSGREFCVATTHLKARHGALLAKLRNEQGRDLIRFVKQFAGD 483

  Fly   242 TPIVLTGDFNSLPDSSPIEFLVG------KNGDVDSTACPEPLHFEIIDSGEGTASTYQNE---- 296
            ||::|.||||:.|.......::|      .:...|.....|.:.....|.||..|.:.:.|    
  Fly   484 TPLLLCGDFNAEPVEPIYATILGCDLLRLGSAYADVKLDREEILHPNADVGEFVAKSMKREPPYT 548

  Fly   297 -WVI---------VDYILRSLGSRSRHKLLPLSVYSLP---SINRC--------IGAGQIPNYRL 340
             |.|         :||                 |:..|   .|..|        ||..:.|:::.
  Fly   549 TWKIREEGEECHTIDY-----------------VFYTPDRLKIKNCLDFPAGEQIGKNRTPSFQY 596

  Fly   341 GSDHYALGAVFTVV 354
            .|||::|...|.::
  Fly   597 PSDHFSLVCDFELL 610

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 85/322 (26%)
cuNP_001097746.1 EEP 312..609 CDD:382041 86/325 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443965
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5239
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D45840at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12121
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.