DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment angel and Cnot6l

DIOPT Version :9

Sequence 1:NP_477204.1 Gene:angel / 37748 FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_006250770.1 Gene:Cnot6l / 360917 RGDID:1309128 Length:555 Species:Rattus norvegicus


Alignment Length:388 Identity:100/388 - (25%)
Similarity:152/388 - (39%) Gaps:115/388 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 RRWTSLGNQAEGRD---PHKCSSFKVVSYNILAQDLLLEHLFLYVGIPHEFLSWQRRQQNLLREL 109
            |.|.:|    :.||   |  .:||.|:.||:|........|:.|  .|...|:|:.|::.::.|:
  Rat   172 RPWITL----KERDQILP--SASFTVMCYNVLCDKYATRQLYGY--CPSWALNWEYRKKGIMEEI 228

  Fly   110 LKLDPDILCLQEMQFDH-----LPVLVQRLRMG--NGKKLAYVYKKKTGCRTDGCAIVYDSSKFE 167
            :..|.||:.|||::.:.     ||.|..|...|  :.|..|.:..::.....|||||.:.:.||.
  Rat   229 VNWDADIISLQEVETEQYFTLFLPALKDRGYDGFFSPKSRAKIMSEQERKHVDGCAIFFKTEKFT 293

  Fly   168 LLDHQAVEL-------YDQAVALLNR----DNVALFARFRFKKQ----------QEQQKEFVVAT 211
            |:....||.       .|.:.|:|||    ||:.:.......|:          ...::..:||.
  Rat   294 LVQKHTVEFNQVAMANSDGSEAMLNRVMTKDNIGVAVVLEVHKELFGTGMKPIHAADKQLLIVAN 358

  Fly   212 THLLFNTKRSDVRCAQ-------VERILEELQS-------FSTDTPIVLTGDFNSLPDSSPIEFL 262
            .|:.::.:.|||:..|       |:.|||:..|       .....|:||..|.||||||..:|:|
  Rat   359 AHMHWDPEYSDVKLIQTMMFVSEVKNILEKASSRPGSPTADPNSIPLVLCADLNSLPDSGVVEYL 423

  Fly   263 --------------------------VGKNGDVDSTACPEPLHFEIIDSGEGTASTYQNEWV--- 298
                                      .||||..:..          |..|....|.|:|..:   
  Rat   424 SNGGVADNHKDFKELRYNECLMNFSCSGKNGSSEGR----------ITHGFQLKSAYENNLMPYT 478

  Fly   299 --------IVDYILRS------LGSRSRHKLLPLSVYSLPSINRCIGAGQIPNYRLGSDHYAL 347
                    ::|||..|      ||     .|.||....|.. |...|.   |:..:.|||::|
  Rat   479 NYTFDFKGVIDYIFYSKTHMNVLG-----VLGPLDPQWLVE-NNITGC---PHPHIPSDHFSL 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 92/363 (25%)
Cnot6lXP_006250770.1 leucine-rich repeat 38..57 CDD:275378
LRR <57..>183 CDD:227223 5/14 (36%)
leucine-rich repeat 58..80 CDD:275378
leucine-rich repeat 81..103 CDD:275378
leucine-rich repeat 104..126 CDD:275378
leucine-rich repeat 127..138 CDD:275378
Deadenylase_CCR4b 191..538 CDD:197339 92/363 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337511
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.