DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment angel and cnot6a

DIOPT Version :9

Sequence 1:NP_477204.1 Gene:angel / 37748 FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_997825.1 Gene:cnot6a / 324048 ZFINID:ZDB-GENE-030131-2768 Length:557 Species:Danio rerio


Alignment Length:394 Identity:103/394 - (26%)
Similarity:159/394 - (40%) Gaps:120/394 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 RRWTSLGNQAEGRDPHK---CSSFKVVSYNILAQDLLLEHLFLYVGIPHEFLSWQRRQQNLLREL 109
            |.|..|      ::|.:   .:.|.|:.||:|........|:.|  .|...|:|:.|::::::|:
Zfish   171 RSWIPL------QEPDRTRPAALFSVMCYNVLCDKYATRQLYGY--CPSWALNWEYRKKSIMQEI 227

  Fly   110 LKLDPDILCLQEMQFD-HLPVLVQRLRMGNGKKLAY--VYKKKTGCRT---------DGCAIVYD 162
            |....||:.|||::.: :....:..|     |:..|  .:..|:..||         ||||:.|.
Zfish   228 LSCSADIISLQEVETEQYYNYFLLEL-----KEQGYEGFFSPKSRARTMSESDRKHVDGCAVFYK 287

  Fly   163 SSKFELLDHQAVELYDQAV-------ALLNR----DNVALFARFRFKKQQEQ----------QKE 206
            :.||.|:....||....|:       |:|||    ||:.:......:|:..:          :|:
Zfish   288 TDKFSLVQKHTVEFNQLAMANSEGSEAMLNRVMTKDNIGVAVLLELRKEMMELSAGKPLHGMEKQ 352

  Fly   207 -FVVATTHLLFNTKRSDVRCAQVERILEE-------------LQSFSTDT---PIVLTGDFNSLP 254
             .:||..|:.::.:.|||:..|....|.|             |.|.|.:|   |:||..|.||||
Zfish   353 LLLVANAHMHWDPEYSDVKLVQTMMFLSEVKNIVDKATRSLKLSSVSGETNAIPLVLCADLNSLP 417

  Fly   255 DSSPIEFLVGKNGDVDSTACPEPLHFEIIDS--------GEGTAST-----------YQNEWV-- 298
            ||..:|:|  ..|.||. |..:......|||        ..||:||           |:|..:  
Zfish   418 DSGVVEYL--STGGVDG-AHKDFKELRYIDSLTNFNCNGKNGTSSTRITHGFKLKSAYENGLMPY 479

  Fly   299 ---------IVDYILRS---------LGSRSRHKLLPLSVYSLPSINRCIGAGQIPNYRLGSDHY 345
                     |:|||..|         ||....|.||.         |...|.   |:..:.|||:
Zfish   480 TNYTFDFKGIIDYIFYSQPLLNVLGVLGPLEHHWLLE---------NNVTGC---PHPHIPSDHF 532

  Fly   346 ALGA 349
            :|.|
Zfish   533 SLFA 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 98/369 (27%)
cnot6aNP_997825.1 LRR_8 51..132 CDD:290566
LRR_4 51..91 CDD:289563
leucine-rich repeat 53..75 CDD:275378
leucine-rich repeat 76..90 CDD:275378
EEP 190..540 CDD:294334 98/369 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576692
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.