DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment angel and Cnot6

DIOPT Version :9

Sequence 1:NP_477204.1 Gene:angel / 37748 FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001380807.1 Gene:Cnot6 / 287249 RGDID:1310783 Length:557 Species:Rattus norvegicus


Alignment Length:454 Identity:108/454 - (23%)
Similarity:172/454 - (37%) Gaps:149/454 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LHNVSLKA---TSRII---------RRSVSSQAKGASGKRKQKAKEMESSHDRNRRWTSLGNQAE 58
            |..:|||.   |..|:         ||.::......||    .||.:.:.....|.|..|     
  Rat   122 LQTLSLKGNPLTQDILNLCLEPDGTRRLLNYLLDNLSG----TAKRISTEQPPPRSWIML----- 177

  Fly    59 GRDPHK---CSSFKVVSYNILAQDLLLEHLFLYVGIPHEFLSWQRRQQNLLRELLKLDPDILCLQ 120
             ::|.:   .:.|.|:.||:|........|:.|  .|...|:|..|::.:::|:|..:.||:.||
  Rat   178 -QEPDRTRPTALFSVMCYNVLCDKYATRQLYGY--CPSWALNWDYRKKAIIQEILSCNADIISLQ 239

  Fly   121 EMQFD--HLPVLVQRLRMG-NGKKLAYVYKKKTGCRT---------DGCAIVYDSSKFELLDHQA 173
            |::.:  :...||:....| ||     .:..|:..||         |||||.:.:.||.|:....
  Rat   240 EVETEQYYSFFLVELKERGYNG-----FFSPKSRARTMSEQERKHVDGCAIFFKTEKFTLVQKHT 299

  Fly   174 VELYDQAV-------ALLNR----DNVALFARFRFKKQQEQ----------QKEFV-VATTHLLF 216
            ||....|:       |:|||    ||:.:......:|:..:          :|:.: ||..|:.:
  Rat   300 VEFNQLAMANSEGSEAMLNRVMTKDNIGVAVLLELRKELIEMSSGKPHLGTEKQLILVANAHMHW 364

  Fly   217 NTKRSDVRCAQVERILEELQSFSTDT---------------PIVLTGDFNSLPDSSPIEFLV--- 263
            :.:.|||:..|....|.|:::.....               |:||..|.||||||..:|:|.   
  Rat   365 DPEYSDVKLVQTMMFLSEVKNIIDKASRSLKSSVLGECGTIPLVLCADLNSLPDSGVVEYLSTGG 429

  Fly   264 -----------------------GKNGDVDSTACPEPLHFEIIDSGEGTASTYQNEWV------- 298
                                   ||||..:..          |..|....|.|:|..:       
  Rat   430 VETNHKDFKELRYNESLTNFSCNGKNGMTNGR----------ITHGFKLKSAYENGLMPYTNYTF 484

  Fly   299 ----IVDYILRS---------LGSRSRHKLLPLSVYSLPSINRCIGAGQIPNYRLGSDHYALGA 349
                |:|||..|         ||....|.|:.      .:|:.|      |:..:.|||::|.|
  Rat   485 DFKGIIDYIFYSKPQLNTLAILGPLDHHWLVE------NNISGC------PHPLIPSDHFSLFA 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 91/375 (24%)
Cnot6NP_001380807.1 LRR <52..>159 CDD:227223 8/36 (22%)
LRR 1 52..73
leucine-rich repeat 53..75 CDD:275378
LRR 2 75..96
leucine-rich repeat 76..98 CDD:275378
LRR 3 98..120
leucine-rich repeat 99..121 CDD:275378
LRR 4 121..143 6/20 (30%)
leucine-rich repeat 122..133 CDD:275378 4/10 (40%)
Nuclease domain. /evidence=ECO:0000250 153..557 100/423 (24%)
Deadenylase_CCR4a 191..540 CDD:197340 91/375 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337514
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.