DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment angel and Pde12

DIOPT Version :9

Sequence 1:NP_477204.1 Gene:angel / 37748 FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_848783.3 Gene:Pde12 / 211948 MGIID:2443226 Length:608 Species:Mus musculus


Alignment Length:385 Identity:91/385 - (23%)
Similarity:144/385 - (37%) Gaps:103/385 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SGKRKQKAKEMES-----------SHDRNRRWTSLGNQAEGRDPHKCSSFKVVSYNILAQDLLLE 83
            :|:|...::|:||           :.|....:|        :...:.|..:.||||||| |...:
Mouse   253 NGQRFGPSRELESLCPVEAGPGTCTFDHRHLYT--------KKVTEDSFIRTVSYNILA-DTYAQ 308

  Fly    84 HLF----LYVGIPHEFLSWQRRQQNLLRELLKLDPDILCLQEMQ----FDHL-PVLVQRLRMGNG 139
            ..|    ||.......|....||..:.:||...:.|::||||:.    .|.| |.|       ..
Mouse   309 TEFSRTVLYPYCAPYALELDYRQNLIQKELTGYNADLICLQEVDRAVFSDSLVPAL-------EA 366

  Fly   140 KKLAYVYKKKTGCRTDGCAIVYDSSKFELLDHQAVELYD------------QAVAL--------L 184
            ..|..|::.|   :.:|.|..|..|||.||....:...:            :.:||        |
Mouse   367 FGLEGVFRIK---QHEGLATFYRKSKFRLLSQHDISFQEALKSDPLHKELLEKLALNPLAQEKVL 428

  Fly   185 NRDNVALFARFRFKKQQEQQKEFVVATTHLLFNTKRSDVRCAQVERILEELQSFSTD----TPIV 245
            .|.:|...:  ..:...:..|:..||.|||.::.|...:|..|:|..|..::..|.|    .|::
Mouse   429 QRSSVLQIS--VLQSTTDSSKKICVANTHLYWHPKGGYIRLIQMEVALVHIRHVSRDLYPGIPVI 491

  Fly   246 LTGDFNSLPDSSPIEFLV-----------GKNGDVD------------STACPEPLHFEIIDSGE 287
            ..|||||.|.:....|::           ..||:.:            .:||.||.:...:....
Mouse   492 FCGDFNSTPSTGMYHFVISGSIAEDHEDWASNGEEERCSMPLSHCFKLKSACGEPAYTNYVGGFH 556

  Fly   288 GTASTYQNEWVIVDYILRSLGSRSRHKLLPLSVYSLPSINRCIGAGQIPNYRLGSDHYAL 347
            |          .:|||...|.:....:::|     |||.........:|:....|||.||
Mouse   557 G----------CLDYIFIDLNTLEVEQVIP-----LPSHEEVTTHQALPSVSHPSDHIAL 601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 83/334 (25%)
Pde12NP_848783.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..111
EEP 298..607 CDD:294334 82/332 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.