DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment angel and PDE12

DIOPT Version :9

Sequence 1:NP_477204.1 Gene:angel / 37748 FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_808881.3 Gene:PDE12 / 201626 HGNCID:25386 Length:609 Species:Homo sapiens


Alignment Length:384 Identity:89/384 - (23%)
Similarity:141/384 - (36%) Gaps:103/384 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GKRKQKAKEMES-----------SHDRNRRWTSLGNQAEGRDPHKCSSFKVVSYNILAQDLLLEH 84
            |:|...::|:||           :.|....:|        :...:.:..:.||||||| |...:.
Human   255 GQRFGHSRELESVCVVEAGPGTCTFDHRHLYT--------KKVTEDALIRTVSYNILA-DTYAQT 310

  Fly    85 LF----LYVGIPHEFLSWQRRQQNLLRELLKLDPDILCLQEMQ----FDHL-PVLVQRLRMGNGK 140
            .|    ||.......|....||..:.:||...:.|::||||:.    .|.| |.|       ...
Human   311 EFSRTVLYPYCAPYALELDYRQNLIQKELTGYNADVICLQEVDRAVFSDSLVPAL-------EAF 368

  Fly   141 KLAYVYKKKTGCRTDGCAIVYDSSKFELLDHQAVELYDQAVA--------------------LLN 185
            .|..|::.|   :.:|.|..|..|||.||....:..|:...:                    :|.
Human   369 GLEGVFRIK---QHEGLATFYRKSKFSLLSQHDISFYEALESDPLHKELLEKLVLYPSAQEKVLQ 430

  Fly   186 RDNVALFARFRFKKQQEQQKEFVVATTHLLFNTKRSDVRCAQVERILEELQSFSTD----TPIVL 246
            |.:|...:..:..|  :..|...||.|||.::.|...:|..|:...|..::..|.|    .|::.
Human   431 RSSVLQVSVLQSTK--DSSKRICVANTHLYWHPKGGYIRLIQMAVALAHIRHVSCDLYPGIPVIF 493

  Fly   247 TGDFNSLPDSSPIEFLV-----------GKNGDVD------------STACPEPLHFEIIDSGEG 288
            .|||||.|.:....|::           ..||:.:            .:||.||.:...:....|
Human   494 CGDFNSTPSTGMYHFVINGSIPEDHEDWASNGEEERCNMSLTHFFKLKSACGEPAYTNYVGGFHG 558

  Fly   289 TASTYQNEWVIVDYILRSLGSRSRHKLLPLSVYSLPSINRCIGAGQIPNYRLGSDHYAL 347
                      .:|||...|.:....:::|     |||.........:|:....|||.||
Human   559 ----------CLDYIFIDLNALEVEQVIP-----LPSHEEVTTHQALPSVSHPSDHIAL 602

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 82/334 (25%)
PDE12NP_808881.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..111
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..230
EEP 299..608 CDD:294334 81/332 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.