DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment angel and angl-1

DIOPT Version :9

Sequence 1:NP_477204.1 Gene:angel / 37748 FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001303707.1 Gene:angl-1 / 189127 WormBaseID:WBGene00020955 Length:520 Species:Caenorhabditis elegans


Alignment Length:260 Identity:86/260 - (33%)
Similarity:130/260 - (50%) Gaps:26/260 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SSQAKGASGKRKQKAKEMESSHDRN--------RRWTSLGNQAEGRDPHKCSSFKVVSYNILAQD 79
            ||.:..::|..:|..|::.....|:        |.|.....|:..:.|...|.|.:.|||:|.|.
 Worm   223 SSSSPSSTGTTQQTFKKINDGFSRDCKDFKRLVRCWNRTEAQSRSKIPKISSKFTICSYNVLCQK 287

  Fly    80 LL--LEHLFLYVGIPHEFLSWQRRQQNLLRELLKLDPDILCLQEMQFDHLPVLVQRLRMGNGKKL 142
            .:  .::|:.::....:||.|:.|.:.|..||...|.|||.|||:|.||.....|.|.    ||.
 Worm   288 TIARTDYLYRHLQGSAQFLDWEHRWRGLQVELPTFDADILGLQEVQADHFVEHFQPLM----KKY 348

  Fly   143 AY--VYKKKTGC--RTDGCAIVYDSSKFELLDHQAVELYDQAVALLNRDNVALFARFRFKKQQEQ 203
            .|  |||:|.|.  :.||||:.|..:||||:.:|.|..:....|:.||:|:|.....|.:..:|.
 Worm   349 GYEGVYKQKFGTQQKDDGCALFYHPAKFELVANQEVNYFISDTAISNRENIAQIVALRCRITKEL 413

  Fly   204 QKEFVVATTHLLFNTKRSDVRCAQVERILEELQSFSTD-----TPIVLTGDFNSLPDSSPIEFLV 263
               .:||.||||||.:|.||:.||:..:...:.....|     .|:.:.||||..|:|...:|:|
 Worm   414 ---ILVANTHLLFNEERGDVKLAQLAILFASIHKMREDFAPMVPPVFVMGDFNIEPNSKVYDFIV 475

  Fly   264  263
             Worm   476  475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
angelNP_477204.1 EEP 70..351 CDD:294334 74/205 (36%)
angl-1NP_001303707.1 EEP 280..>478 CDD:382041 74/203 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158545
Domainoid 1 1.000 112 1.000 Domainoid score I3905
eggNOG 1 0.900 - - E1_COG5239
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D395901at33208
OrthoFinder 1 1.000 - - FOG0002618
OrthoInspector 1 1.000 - - oto18037
orthoMCL 1 0.900 - - OOG6_105310
Panther 1 1.100 - - LDO PTHR12121
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1517
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.710

Return to query results.
Submit another query.