DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and ibpA

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_418142.1 Gene:ibpA / 948200 ECOCYCID:EG11534 Length:137 Species:Escherichia coli


Alignment Length:119 Identity:29/119 - (24%)
Similarity:57/119 - (47%) Gaps:14/119 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 HTNSLQKQESG-----STLNIDSEKFEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYV 118
            |..:.|.|.:|     :...:|...:.:.:.|..|:.||:.:...|..::|:|.|.::|.|..|:
E. coli    22 HLENNQSQSNGGYPPYNVELVDENHYRIAIAVAGFAESELEITAQDNLLVVKGAHADEQKERTYL 86

  Fly   119 -----SRQFSRRYQLPSDVNPDTVTSSLSSDGLLTIKAPMKALPPPQTERLVQI 167
                 .|.|.|::||..:::   |..:...:|||.|... :.:|..:..|.::|
E. coli    87 YQGIAERNFERKFQLAENIH---VRGANLVNGLLYIDLE-RVIPEAKKPRRIEI 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 22/86 (26%)
ibpANP_418142.1 PRK10743 1..137 CDD:182691 29/119 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 42 1.000 Domainoid score I751
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I484
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.