DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and ibpB

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_418141.2 Gene:ibpB / 948192 ECOCYCID:EG11535 Length:142 Species:Escherichia coli


Alignment Length:134 Identity:28/134 - (20%)
Similarity:60/134 - (44%) Gaps:20/134 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 SGYLRPW-----HTNSLQ---KQESGSTLNI---DSEKFEVILDVQQFSPSEITVKVADKFVIVE 105
            |..:|.|     ..|:||   :.:|....||   |...:.:.|.:..|...::.:::....:.|:
E. coli     7 SPLMRQWIGFDKLANALQNAGESQSFPPYNIEKSDDNHYRITLALAGFRQEDLEIQLEGTRLSVK 71

  Fly   106 GKHEEKQDE-----HGYVSRQFSRRYQLPSDVNPDTVTSSLSSDGLLTIKAPMKALPPPQTERLV 165
            |..|:.::|     .|.:::.||..:.|..::.   |:.:...:|||.|.. ::..|.|...:.:
E. coli    72 GTPEQPKEEKKWLHQGLMNQPFSLSFTLAENME---VSGATFVNGLLHIDL-IRNEPEPIAAQRI 132

  Fly   166 QITQ 169
            .|::
E. coli   133 AISE 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 18/89 (20%)
ibpBNP_418141.2 PRK11597 1..142 CDD:183223 28/134 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 42 1.000 Domainoid score I751
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I484
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.