DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and AT1G59860

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_176195.1 Gene:AT1G59860 / 842280 AraportID:AT1G59860 Length:155 Species:Arabidopsis thaliana


Alignment Length:178 Identity:43/178 - (24%)
Similarity:69/178 - (38%) Gaps:67/178 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVVPLMF---------------RDWWD---ELDFPMRTSRLLDQHFGQGLKRDDLMSSVWNSRP 47
            ||::|..|               .|.||   ||.||..:|                 |::.|:|.
plant     1 MSLIPSFFGNNRRINNNIFDPFSLDVWDPFKELQFPSSSS-----------------SAIANARV 48

  Fly    48 TVLRSGYLRPWHTNSLQKQESGSTLNIDSEKFEVILDVQQFSPSEITVKVADKFVI-VEGKH--- 108
                     .|...:            ::..|:.  |:......|:.|::.|..|: :.|:.   
plant    49 ---------DWKETA------------EAHVFKA--DLPGMKKEEVKVEIEDDSVLKISGERHVE 90

  Fly   109 -EEKQDEHGYVSRQ---FSRRYQLPSDVNPDTVTSSLSSDGLLTIKAP 152
             |||||....|.|.   |||:::||.:|..|.|.:|: .:|:||:..|
plant    91 KEEKQDTWHRVERSSGGFSRKFRLPENVKMDQVKASM-ENGVLTVTVP 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 27/90 (30%)
AT1G59860NP_176195.1 ACD_ScHsp26_like 47..138 CDD:107229 29/115 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.