DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and AT1G52560

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_175665.1 Gene:AT1G52560 / 841687 AraportID:AT1G52560 Length:232 Species:Arabidopsis thaliana


Alignment Length:187 Identity:36/187 - (19%)
Similarity:64/187 - (34%) Gaps:63/187 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DFPMRTSRLLDQHFGQGLKRDDLMSSVWNSRPTVLRSGYLRPWHTNSLQKQESGSTL-------- 72
            :||.|..|                .|:|.:...   .||..| ..|.......|:||        
plant    68 NFPRRRGR----------------KSLWRNTDD---HGYFTP-TLNEFFPPTIGNTLIQATENMN 112

  Fly    73 ----NIDSEKFEVILDVQQ-------------FSPSEITVKVADKFVIVEGKH---EEK----QD 113
                |.:...|:::..|::             .:..::.:.|.|..:.::|.|   |||    :|
plant   113 RIFDNFNVNPFQLMGQVKEQDDCYKLRYEVPGLTKEDVKITVNDGILTIKGDHKAEEEKGSPEED 177

  Fly   114 E------HGYVSRQFSRRYQLPSDVNPDTVTSSLSSDGLLTIKAPMKALPPPQTERL 164
            |      :||.:...|    ||.|...:.:.:.| .:|:|.:..|....|....:.:
plant   178 EYWSSKSYGYYNTSLS----LPDDAKVEDIKAEL-KNGVLNLVIPRTEKPKKNVQEI 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 23/119 (19%)
AT1G52560NP_175665.1 ACD_sHsps-like 129..218 CDD:107221 19/93 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.