DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and AT1G07400

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_172220.1 Gene:AT1G07400 / 837252 AraportID:AT1G07400 Length:157 Species:Arabidopsis thaliana


Alignment Length:177 Identity:45/177 - (25%)
Similarity:71/177 - (40%) Gaps:63/177 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVVPLMF--------------RDWWD---ELDFPMRTSRLLDQHFGQGLKRDDLMSSVWNSRPT 48
            ||::|..|              .|.||   ||.||...|       |:       .|::.|:|. 
plant     1 MSLIPSFFGNNRRSNSIFDPFSLDVWDPFKELQFPSSLS-------GE-------TSAITNARV- 50

  Fly    49 VLRSGYLRPWHTNSLQKQESGSTLNIDSEKFEVILDVQQFSPSEITVKVADKFVI-VEGKH---- 108
                    .|...:            ::..|:.  |:......|:.|::.|..|: :.|:.    
plant    51 --------DWKETA------------EAHVFKA--DLPGMKKEEVKVEIEDDSVLKISGERHVEK 93

  Fly   109 EEKQDEHGYVSR---QFSRRYQLPSDVNPDTVTSSLSSDGLLTIKAP 152
            |||||....|.|   ||||:::||.:|..|.|.:|: .:|:||:..|
plant    94 EEKQDTWHRVERSSGQFSRKFKLPENVKMDQVKASM-ENGVLTVTVP 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 28/90 (31%)
AT1G07400NP_172220.1 ACD_ScHsp26_like 49..140 CDD:107229 30/115 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.