DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and HSP18.2

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_200780.1 Gene:HSP18.2 / 836093 AraportID:AT5G59720 Length:161 Species:Arabidopsis thaliana


Alignment Length:185 Identity:39/185 - (21%)
Similarity:72/185 - (38%) Gaps:51/185 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVVPLMF------------RDWWDELD-FPMRTSRLLDQHFGQGLKRDDLMSSVWNSRPTVLRS 52
            ||::|.:|            :|.||..: |...:|.|.:....:.:.........|...|     
plant     1 MSLIPSIFGGRRSNVFDPFSQDLWDPFEGFFTPSSALANASTARDVAAFTNARVDWKETP----- 60

  Fly    53 GYLRPWHTNSLQKQESGSTLNIDSEKFEVILDVQQFSPSEITVKVADKFVI-VEG----KHEEKQ 112
                                  ::..|:.  |:......|:.|:|.||.|: :.|    ::|||.
plant    61 ----------------------EAHVFKA--DLPGLKKEEVKVEVEDKNVLQISGERSKENEEKN 101

  Fly   113 DEHGYVSR---QFSRRYQLPSDVNPDTVTSSLSSDGLLTIKAPMKALPPPQTERL 164
            |:...|.|   :|.||::||.:...:.|.::: .:|:||:..|......||.:.:
plant   102 DKWHRVERASGKFMRRFRLPENAKMEEVKATM-ENGVLTVVVPKAPEKKPQVKSI 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 24/89 (27%)
HSP18.2NP_200780.1 ACD_ScHsp26_like 53..144 CDD:107229 26/120 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.