DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and AT5G37670

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_198583.1 Gene:AT5G37670 / 833746 AraportID:AT5G37670 Length:137 Species:Arabidopsis thaliana


Alignment Length:138 Identity:38/138 - (27%)
Similarity:64/138 - (46%) Gaps:27/138 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 RSGYLRPWHTNSLQKQE-SGSTLNID------SEKFEVILDVQQFSPSEITVKVADKFVIV---E 105
            |..:|.|:.    :.|| |.||..||      |..|::  :|..::..:|.|::.:..|:.   |
plant     4 RGIFLYPFR----RFQEWSRSTALIDWMESNNSHIFKI--NVPGYNKEDIKVQIEEGNVLSIRGE 62

  Fly   106 G-KHEEKQDEHGYVSR---------QFSRRYQLPSDVNPDTVTSSLSSDGLLTIKAPMKALPPPQ 160
            | |.|:|::...:|:.         :|.||.:||.:|..|.|.:.: .:|:||:..|........
plant    63 GIKEEKKENLVWHVAEREAFSGGGSEFLRRIELPENVKVDQVKAYV-ENGVLTVVVPKDTSSKSS 126

  Fly   161 TERLVQIT 168
            ..|.|.||
plant   127 KVRNVNIT 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 26/100 (26%)
AT5G37670NP_198583.1 ACD_ScHsp26_like 24..119 CDD:107229 25/97 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.