DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and HSP17.6A

DIOPT Version :10

Sequence 1:NP_523827.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_196764.1 Gene:HSP17.6A / 831076 AraportID:AT5G12030 Length:156 Species:Arabidopsis thaliana


Alignment Length:98 Identity:27/98 - (27%)
Similarity:50/98 - (51%) Gaps:14/98 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 DSEKFEVILDVQQFSPSEITVKVADKFV-IVEGKHEEKQDEHGYVS--------RQFSRRYQLPS 130
            |:..|.|  |:......||.|::.::.| :|.||.:....|:..|.        .:|.|::|||.
plant    55 DAYVFAV--DMPGIKGDEIQVQIENENVLVVSGKRQRDNKENEGVKFVRMERRMGKFMRKFQLPD 117

  Fly   131 DVNPDTVTSSLSSDGLLTIKAPMKALPPPQTER 163
            :.:.:.: |:..:||:|.:..|  .||||:.::
plant   118 NADLEKI-SAACNDGVLKVTIP--KLPPPEPKK 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_523827.1 metazoan_ACD 71..153 CDD:107247 22/86 (26%)
HSP17.6ANP_196764.1 HSP20 49..137 CDD:459629 22/84 (26%)

Return to query results.
Submit another query.