DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and HSP21

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_194497.1 Gene:HSP21 / 828881 AraportID:AT4G27670 Length:227 Species:Arabidopsis thaliana


Alignment Length:157 Identity:35/157 - (22%)
Similarity:65/157 - (41%) Gaps:35/157 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PMRTSR----LLDQHFGQGLKRDDLMSSVWNSRPTVLRSGYLRPWHTNSLQKQESGSTLNIDSEK 78
            ||||.|    .:|:.|      :|.|.....:|.....|....||              :|..|:
plant    91 PMRTMRQMLDTMDRMF------EDTMPVSGRNRGGSGVSEIRAPW--------------DIKEEE 135

  Fly    79 FEVIL--DVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYVSR---QFSRRYQLPSDVNPDTVT 138
            .|:.:  |:...|..::.:.|.|..::::|:.:::..:..:..|   .:..|.|||.:...|.:.
plant   136 HEIKMRFDMPGLSKEDVKISVEDNVLVIKGEQKKEDSDDSWSGRSVSSYGTRLQLPDNCEKDKIK 200

  Fly   139 SSLSSDGLLTIKAPMKALPPPQTERLV 165
            :.| .:|:|.|     .:|..:.||.|
plant   201 AEL-KNGVLFI-----TIPKTKVERKV 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 18/86 (21%)
HSP21NP_194497.1 IbpA 90..225 CDD:223149 35/157 (22%)
HSP20 130..227 CDD:278440 22/98 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.