DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and HSP23.6-MITO

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_194250.1 Gene:HSP23.6-MITO / 828623 AraportID:AT4G25200 Length:210 Species:Arabidopsis thaliana


Alignment Length:161 Identity:38/161 - (23%)
Similarity:66/161 - (40%) Gaps:35/161 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VPLMFRDWWDELDFPMRTSR-------LLDQHFGQGLKRDDLMSSVWNSRPTVLRSGYLRPWHTN 61
            ||....|::.::..|...:|       |:||     ...:.|:|:...    :..||..|.|   
plant    57 VPRRRGDFFSDVFDPFSPTRSVSQVLNLMDQ-----FMENPLLSATRG----MGASGARRGW--- 109

  Fly    62 SLQKQESGSTLNIDS---EKFEVILDVQQFSPSEITVKVADKFVI-VEGKHEEKQDEHGYV-SRQ 121
            .:::::....|.||.   .:.:|.|.::|           |..|| .|||:||...|.|.. :|:
plant   110 DIKEKDDALYLRIDMPGLSREDVKLALEQ-----------DTLVIRGEGKNEEDGGEEGESGNRR 163

  Fly   122 FSRRYQLPSDVNPDTVTSSLSSDGLLTIKAP 152
            |:.|..||..:.......:...:|:|.:..|
plant   164 FTSRIGLPDKIYKIDEIKAEMKNGVLKVVIP 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 24/87 (28%)
HSP23.6-MITONP_194250.1 ACD_sHsps-like 110..195 CDD:107221 24/96 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.