DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and AT4G21870

DIOPT Version :10

Sequence 1:NP_523827.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_193918.1 Gene:AT4G21870 / 828276 AraportID:AT4G21870 Length:134 Species:Arabidopsis thaliana


Alignment Length:116 Identity:25/116 - (21%)
Similarity:48/116 - (41%) Gaps:14/116 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PWH-------TNSLQKQESGSTLNIDSEKFEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQDE 114
            ||.       .|:.|:.....:.:.||..|.|  |:......||.|::.|...::..........
plant    10 PWEYVLASQSLNNYQENHVRWSQSPDSHTFSV--DLPGLRKEEIKVEIEDSIYLIIRTEATPMSP 72

  Fly   115 HGYVSRQFSRRYQLPSDVNPDTVTSSLSSDGLLTIKAPMKALPPPQTERLV 165
            .....:.|.|:::||..::...:::.. .||:||:..|.:.:    |.||:
plant    73 PDQPLKTFKRKFRLPESIDMIGISAGY-EDGVLTVIVPKRIM----TRRLI 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_523827.1 metazoan_ACD 71..153 CDD:107247 17/81 (21%)
AT4G21870NP_193918.1 alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 27..110 CDD:469641 17/85 (20%)

Return to query results.
Submit another query.