DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and ATHSP22.0

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_192763.1 Gene:ATHSP22.0 / 826616 AraportID:AT4G10250 Length:195 Species:Arabidopsis thaliana


Alignment Length:187 Identity:47/187 - (25%)
Similarity:82/187 - (43%) Gaps:50/187 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 WWDELDFPMRTSRLLDQHFGQGLKRDDLMSSVWNSRPTVLRSGYLRPWHTNSLQKQESGSTLNID 75
            |.|....|.:    :.:....||:||   :||..|...|       .|...              
plant    42 WLDRFPDPFK----ILERIPLGLERD---TSVALSPARV-------DWKET-------------- 78

  Fly    76 SEKFEVILDVQQFSPSEITVKVADKFVI-VEG----KHEEKQDEHGYVSR---QFSRRYQLPSDV 132
            :|..|::||:......|:.::|.:..|: |.|    :.|:|.|:...|.|   :|.|:::||.:|
plant    79 AEGHEIMLDIPGLKKDEVKIEVEENGVLRVSGERKREEEKKGDQWHRVERSYGKFWRQFKLPDNV 143

  Fly   133 NPDTVTSSLSSDGLLTIK----APMKALPPPQTERLVQITQTGPSSKEDNAKKVETS 185
            :.::|.:.| .:|:|||.    :|.|...|    |:|.|     :::||...|:.:|
plant   144 DMESVKAKL-ENGVLTINLTKLSPEKVKGP----RVVNI-----AAEEDQTAKISSS 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 25/93 (27%)
ATHSP22.0NP_192763.1 IbpA 42..177 CDD:223149 42/167 (25%)
ACD_ScHsp26_like 72..163 CDD:107229 27/112 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.