DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and HSP17.4

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_190209.1 Gene:HSP17.4 / 823768 AraportID:AT3G46230 Length:156 Species:Arabidopsis thaliana


Alignment Length:179 Identity:43/179 - (24%)
Similarity:70/179 - (39%) Gaps:46/179 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVVPLMFRDWWDELDFPMRTSRLLDQHFGQGLKR----DDLMSSVWNSRPTVLRSGYLRPWHTN 61
            ||:||..|                       |.:|    |.....||:.     ..|:|.|..||
plant     1 MSLVPSFF-----------------------GGRRTNVFDPFSLDVWDP-----FEGFLTPGLTN 37

  Fly    62 SLQKQESGST-LNID----SEKFEVILDVQQFSPSEITVKVADKFVI-VEG----KHEEKQDEHG 116
            :..|..:..| ..:|    .|......||......|:.|:|.|..:: :.|    ::|||.|...
plant    38 APAKDVAAFTNAKVDWRETPEAHVFKADVPGLKKEEVKVEVEDGNILQISGERSSENEEKSDTWH 102

  Fly   117 YVSR---QFSRRYQLPSDVNPDTVTSSLSSDGLLTIKAPMKALPPPQTE 162
            .|.|   :|.||::||.:...:.|.:|: .:|:|::..|......|:.:
plant   103 RVERSSGKFMRRFRLPENAKVEEVKASM-ENGVLSVTVPKVQESKPEVK 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 25/94 (27%)
HSP17.4NP_190209.1 ACD_ScHsp26_like 50..141 CDD:107229 24/91 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.