DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and AT2G29500

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_180511.1 Gene:AT2G29500 / 817499 AraportID:AT2G29500 Length:153 Species:Arabidopsis thaliana


Alignment Length:186 Identity:42/186 - (22%)
Similarity:80/186 - (43%) Gaps:52/186 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVVPLMFRDWWDELDFPMRTSRLLDQHFGQGLKRDDLMSSVWNSRPTVLRSGYLRPWH--TNSL 63
            ||::|..|.:        .|.|.:.          |.....||:            |:.  |:|.
plant     1 MSMIPSFFNN--------NRRSNIF----------DPFSLDVWD------------PFKELTSSS 35

  Fly    64 QKQESGSTLNI--------DSEKFEVILDVQQFSPSEITVKVADKFVI-VEG-KHEEKQDEHGYV 118
            ..:|:.:.:|.        ::..|:.  |:......|:.|::.:..|: :.| :|.||:|::...
plant    36 LSRENSAIVNARVDWRETPEAHVFKA--DLPGLKKEEVKVEIEEDSVLKISGERHVEKEDKNDTW 98

  Fly   119 SR------QFSRRYQLPSDVNPDTVTSSLSSDGLLTIKAPMKALPPPQTERLVQIT 168
            .|      ||:||::||.:|..|.|.::: .:|:||:..| ||.......:.:||:
plant    99 HRVERSSGQFTRRFRLPENVKMDQVKAAM-ENGVLTVTVP-KAETKKADVKSIQIS 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 24/97 (25%)
AT2G29500NP_180511.1 ACD_ScHsp26_like 47..138 CDD:107229 24/94 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.