DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and Hspb8

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_109629.1 Gene:Hspb8 / 80888 MGIID:2135756 Length:196 Species:Mus musculus


Alignment Length:157 Identity:64/157 - (40%)
Similarity:85/157 - (54%) Gaps:20/157 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DFPMRTSRLLDQHFGQGLKRDDL-----------MSSVWNSRPTVLRSGYL---RPWHTNSLQKQ 66
            |.|: :|||||..||.....|||           :||.|   |..||||.:   .|.........
Mouse    23 DSPL-SSRLLDDGFGMDPFPDDLTAPWPEWALPRLSSAW---PGTLRSGMVPRGPPATARFGVPA 83

  Fly    67 ESGSTLNIDSEKFEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYVSRQFSRRYQLPSD 131
            |..|......|.::|.::|..|.|.|:.||..|.:|.|.|||||||.|.|.||:.|:::.|||::
Mouse    84 EGRSPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAE 148

  Fly   132 VNPDTVTSSLSSDGLLTIKAPMKALPP 158
            |:|.||.:|||.:|||.|:||.  :||
Mouse   149 VDPATVFASLSPEGLLIIEAPQ--VPP 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 38/81 (47%)
Hspb8NP_109629.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28 2/5 (40%)
ACD_HspB8_like 80..170 CDD:107235 40/89 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..196
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839003
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.