DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and hspb6

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001094428.1 Gene:hspb6 / 792610 ZFINID:ZDB-GENE-080214-7 Length:142 Species:Danio rerio


Alignment Length:108 Identity:45/108 - (41%)
Similarity:66/108 - (61%) Gaps:14/108 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 KQESGSTLNIDSEKFEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYVSRQFSRRYQLP 129
            :|...|.:..|...|.|.:||:.|||.|:.|||:..:|:||||||:|:|..|.|:|||:|||::|
Zfish    47 EQTGASKVTCDHNGFTVEVDVKHFSPEELLVKVSGDYVVVEGKHEQKKDGSGLVTRQFNRRYRIP 111

  Fly   130 SDVNPDTVTSSLSSDGLLTIKAPMKALPPPQTERLVQITQTGP 172
            :.||...:.|::|.:|:|.|.||              :|||.|
Zfish   112 NGVNIMALESAMSPEGMLVISAP--------------LTQTIP 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 38/81 (47%)
hspb6NP_001094428.1 metazoan_ACD 53..135 CDD:107247 39/95 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X393
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.