DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and Hspb3

DIOPT Version :10

Sequence 1:NP_523827.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_113938.1 Gene:Hspb3 / 78951 RGDID:68345 Length:152 Species:Rattus norvegicus


Alignment Length:79 Identity:27/79 - (34%)
Similarity:54/79 - (68%) Gaps:2/79 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 KFEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYVSRQFSRRYQLPSDVNPDTVTSSLS 142
            :|:::|||.||.|.:|.::..:.:::::.:|..:.||||::||.|:|:|:||..|....:::.|.
  Rat    72 RFQILLDVVQFLPEDIIIQTFEGWLLIKAQHGTRMDEHGFISRSFTRQYKLPDGVETKDLSAILC 136

  Fly   143 SDGLLT--IKAPMK 154
            .||:|.  :|.|::
  Rat   137 HDGILVVEVKDPLE 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_523827.1 metazoan_ACD 71..153 CDD:107247 26/76 (34%)
Hspb3NP_113938.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..69
ACD_HspB3_Like 65..147 CDD:107232 25/74 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.