DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and Hspb9

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_083583.2 Gene:Hspb9 / 75482 MGIID:1922732 Length:168 Species:Mus musculus


Alignment Length:105 Identity:31/105 - (29%)
Similarity:53/105 - (50%) Gaps:11/105 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 DSEKFEVILDVQQFSPSEITVKVADKFVIVEG--KHEEKQDEHG--YVSRQFSRRYQLPSDVNPD 135
            :...|::.:|.|.|:|.::.|::..:.:.|.|  :||......|  .:.:...|:.|||..::|.
Mouse    53 EQPSFQIKVDAQGFAPEDLVVRIDGQNLTVTGQRQHESNDPSRGRYRMEQSVHRQMQLPPTLDPA 117

  Fly   136 TVTSSLSSDGLLTIKAPMKALPPPQTERLVQITQTGPSSK 175
            .:|.||:..|.|.::...|.||||:       .|||.|.|
Mouse   118 AMTCSLTPSGHLWLRGQNKCLPPPE-------AQTGQSQK 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 21/81 (26%)
Hspb9NP_083583.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
ACD_HspB9_like 50..135 CDD:107236 21/81 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 83..104 4/20 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..168 11/29 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838997
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.