DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and hspb3

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001092922.1 Gene:hspb3 / 568180 ZFINID:ZDB-GENE-070705-338 Length:150 Species:Danio rerio


Alignment Length:147 Identity:40/147 - (27%)
Similarity:69/147 - (46%) Gaps:35/147 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GQGLKRDDLMSSVWNSRPTVLRSGYLRPWHTNSLQKQESGSTL-----------NIDSE------ 77
            |:|     :..|.|.|.|.    .|.:.:.|.:||:......|           .:|:|      
Zfish     3 GEG-----ITISHWISSPV----RYQQLFKTRNLQESTEDHRLFALPGPECLPVKVDTEGAQADS 58

  Fly    78 --------KFEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYVSRQFSRRYQLPS-DVN 133
                    .|:::|||.||.|.:|.::|.:.::::.|:|..:..|||.|||.|:|.||||. .::
Zfish    59 EDEDSGEPMFQILLDVTQFKPEDILIQVFEGWLLIRGRHGVRMGEHGLVSRSFTRHYQLPDCQLH 123

  Fly   134 PDTVTSSLSSDGLLTIK 150
            ...:.:.|..||:|.::
Zfish   124 AGDLKAMLCHDGMLVVE 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 30/106 (28%)
hspb3NP_001092922.1 ACD_HspB3_Like 60..143 CDD:107232 27/81 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582850
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.