DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and Hspb3

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_064344.1 Gene:Hspb3 / 56534 MGIID:1928479 Length:154 Species:Mus musculus


Alignment Length:107 Identity:33/107 - (30%)
Similarity:62/107 - (57%) Gaps:3/107 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PTVLRSGYLRPWHTNSLQKQESGSTLNIDSE---KFEVILDVQQFSPSEITVKVADKFVIVEGKH 108
            ||:......|...|.....::|.||.....|   :|:::|||.||.|.:|.::..:.:::::.:|
Mouse    40 PTIEDLSKARGAGTPQALAEDSASTEKPPGEGKSRFQILLDVVQFLPEDIIIQTFEGWLLIKAQH 104

  Fly   109 EEKQDEHGYVSRQFSRRYQLPSDVNPDTVTSSLSSDGLLTIK 150
            ..:.||||::||.|:|:|:||..|....:::.|..||:|.::
Mouse   105 GTRMDEHGFISRSFTRQYKLPDGVETKDLSAILCHDGILVVE 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 27/83 (33%)
Hspb3NP_064344.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..71 5/22 (23%)
ACD_HspB3_Like 67..149 CDD:107232 26/80 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838971
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.