DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and cryabb

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:XP_021331756.1 Gene:cryabb / 436943 ZFINID:ZDB-GENE-040718-419 Length:180 Species:Danio rerio


Alignment Length:167 Identity:59/167 - (35%)
Similarity:99/167 - (59%) Gaps:24/167 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FPMRTSRLLDQHFGQGLKRDDLMSSVWNSRPTVLRSGYLRPWHTNSLQKQESG-STLNIDSEKFE 80
            ||.|       .||:.:...|::||:::.|.:.|||   ..|       .||| |.:.::.::|.
Zfish    18 FPRR-------QFGEHITEADVISSLYSQRSSFLRS---PSW-------MESGVSEVKMEKDQFS 65

  Fly    81 VILDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYVSRQFSRRYQLPSDVNPDTVTSSLSSDG 145
            :.|||:.|:|.|::||:...|:.:..|||::||.||:|||:|.|:|::|..|:|.::||||||||
Zfish    66 LSLDVKHFAPEELSVKIIGDFIEIHAKHEDRQDGHGFVSREFLRKYRVPVGVDPASITSSLSSDG 130

  Fly   146 LLTIKAPMKALPPPQTERLVQITQ------TGPSSKE 176
            :||:..|:|....|:....:.:|:      .||..::
Zfish   131 VLTVTGPLKLSDGPERTIAIPVTRDDKTTVAGPQKRK 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 36/81 (44%)
cryabbXP_021331756.1 Crystallin 1..48 CDD:306911 12/39 (31%)
ACD_HspB4-5-6 56..137 CDD:107233 36/80 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582877
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68209
Inparanoid 1 1.050 118 1.000 Inparanoid score I4775
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 1 1.000 - - otm26160
orthoMCL 1 0.900 - - OOG6_101545
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 1 1.000 - - X393
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.930

Return to query results.
Submit another query.