DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and Hsp27

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001287001.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster


Alignment Length:219 Identity:86/219 - (39%)
Similarity:119/219 - (54%) Gaps:41/219 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVVPLMFRDWWDELDFPMRT--SRLLDQHFGQGLKRDDLMSSVWNSRPTVLRSGYLR--PW--- 58
            ||::||:...  .|||...||  ..||:..||.|:...||........|..|..|..|  |:   
  Fly     1 MSIIPLLHLA--RELDHDYRTDWGHLLEDDFGFGVHAHDLFHPRRLLLPNTLGLGRRRYSPYERS 63

  Fly    59 --HTNSLQKQESGSTLN-----IDSEKFEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHG 116
              |.|.:.::.||.. |     :..:.|:|.:||.||.|:|:||||.|..|:|||||||::|.||
  Fly    64 HGHHNQMSRRASGGP-NALLPAVGKDGFQVCMDVSQFKPNELTVKVVDNTVVVEGKHEEREDGHG 127

  Fly   117 YVSRQFSRRYQLPSDVNPDTVTSSLSSDGLLTIKAPMKALPPP-----QTERLVQITQTGPS--- 173
            .:.|.|.|:|.||...:|:.|.|::||||:||:|||    |||     ::||:|||.||||:   
  Fly   128 MIQRHFVRKYTLPKGFDPNEVVSTVSSDGVLTLKAP----PPPSKEQAKSERIVQIQQTGPAHLS 188

  Fly   174 ----------SKEDN--AKKVETS 185
                      .|.:|  .:|:|||
  Fly   189 VKAPAPEAGDGKAENGSGEKMETS 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 42/86 (49%)
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 40/76 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452096
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 1 0.900 - - E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 1 1.000 - - otm14686
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X393
109.900

Return to query results.
Submit another query.