DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and Hsp67Ba

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_523998.1 Gene:Hsp67Ba / 39076 FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster


Alignment Length:243 Identity:74/243 - (30%)
Similarity:112/243 - (46%) Gaps:64/243 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVVPLMFRDWWDEL-DF-----------------PMRTSRLLDQHFGQGLKRDDLM-------- 39
            ||::|.:. |..:|| ||                 |:..:..|.| ..:||.|.:.|        
  Fly     1 MSLIPFIL-DLAEELHDFNRSLAMDIDDSAGFGLYPLEATSQLPQ-LSRGLGRGNAMMWVPIKGQ 63

  Fly    40 --SSVWNSRPTVLRSGYLRPWHTNSLQKQE-----------SGSTLN-----------IDSEKFE 80
              :|.....|....:|........||.:.|           ||||..           ::...|:
  Fly    64 SAASQHRHHPYNRVAGAKTACCNKSLVELEKELGDKGTSGASGSTSGQPAASKSAYSVVNRNGFQ 128

  Fly    81 VILDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYVSRQFSRRYQLPSDVNPDTVTSSLSSDG 145
            |.::|:||:.:|:|||..|..::|||:|:||:|.||.:||.|.|:|.||...:|:.|.|:|||||
  Fly   129 VSMNVKQFAANELTVKTIDNCIVVEGQHDEKEDGHGVISRHFIRKYILPKGYDPNEVHSTLSSDG 193

  Fly   146 LLTIKAPMKALPP--------PQTERLVQITQTGPSSKEDNAKKVETS 185
            :||:|||    ||        .:.||:|.|.|.....|:.:|:..:.|
  Fly   194 ILTVKAP----PPLPVVKGSLERQERIVDIQQISQQQKDKDAQPPKPS 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 39/92 (42%)
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 37/75 (49%)
DNA_pol3_delta2 <218..>381 CDD:331068 5/20 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469594
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 1 0.900 - - E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I3937
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 1 1.000 - - otm14686
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45640
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 00.000 Not matched by this tool.
109.930

Return to query results.
Submit another query.