DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and CG4461

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster


Alignment Length:202 Identity:71/202 - (35%)
Similarity:95/202 - (47%) Gaps:40/202 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVVPLMFRDWWDELDFPMRTSRLLDQHFGQGLKR---DDLMSSVWNSRPTVLRSGYLRP----- 57
            ||:||..:||...|.|   |...|....:...|..   ||  |.:|...|...||..|||     
  Fly     1 MSLVPTTYRDLSREFD---RLRPLYHPPYDFQLYPYLWDD--SRLWWPSPHTSRSDLLRPLDELV 60

  Fly    58 ---------------W-HTNSLQKQESGSTLNIDSEKFEVILDVQQFSPSEITVKVADKFVIVEG 106
                           | |........||..:::|.:.|.:.:||:||.|.:|.||..|.:|||:|
  Fly    61 SRRVRNQLIQSTPYEWAHPMRWDNYYSGERVHVDEKGFRIDIDVRQFHPHDIVVKTNDDYVIVQG 125

  Fly   107 KHEEKQD-EHGYVSRQFSRRYQLPSDVNPDTVTSSLSSDGLLTIKAPMKALPPPQT------ERL 164
            .|..:.: .:|.|.|.|.|:|.||...|.:.|.|.:||||:||||||    |||..      |||
  Fly   126 NHNRRDEGSNGLVERHFVRKYLLPRGYNANEVISDISSDGILTIKAP----PPPPAKYYTPGERL 186

  Fly   165 VQITQTG 171
            |::.:||
  Fly   187 VRVHETG 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 36/82 (44%)
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 32/74 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 1 0.900 - - E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X393
87.970

Return to query results.
Submit another query.