DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and Hsp22

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster


Alignment Length:128 Identity:54/128 - (42%)
Similarity:74/128 - (57%) Gaps:17/128 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 QKQESGSTLNIDSEKFEVILDVQQFSPSEITVKVADK-FVIVEGKHEEKQDEH-GYVSRQFSRRY 126
            |:||......::.:.:::.|||:.:  ||:.|||.|: .|:||||.|:::.|. ||.||.|.||:
  Fly    49 QEQEFAPPATVNKDGYKLTLDVKDY--SELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRF 111

  Fly   127 QLPSDVNPDTVTSSLSSDGLLTIKAPMKALPPPQT-----ERLVQITQTG----PSSKEDNAK 180
            .||.....|.|||:|||||:|||..|    .||..     ||.|.|.|||    .|::|.|.|
  Fly   112 VLPEGYEADKVTSTLSSDGVLTISVP----NPPGVQETLKEREVTIEQTGEPAKKSAEEPNDK 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 37/83 (45%)
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 46/110 (42%)
metazoan_ACD 61..138 CDD:107247 38/82 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469606
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 1 0.900 - - E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.