DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and hspb1

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001008615.2 Gene:hspb1 / 368243 ZFINID:ZDB-GENE-030326-4 Length:199 Species:Danio rerio


Alignment Length:176 Identity:58/176 - (32%)
Similarity:93/176 - (52%) Gaps:39/176 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FRDWWDELDFPMRTSRLLDQHFGQGLKRDDLMSSVWNSRPTVLRSGYLRPW-------------- 58
            ||||:       :.|||.||.||.....:::::.     |:....||:||:              
Zfish    19 FRDWY-------QGSRLFDQSFGMPALSEEMLTF-----PSTHWPGYMRPFGHPEFASLMQGPPV 71

  Fly    59 --------HTNSLQKQESG--STLNIDSEKFEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQD 113
                    :..:|.:|.|.  |.:....:.:::.|||..|||.|:.||..|..:.:.|||||::|
Zfish    72 MPPMMTPSYGRALSRQLSSGMSEVKQTGDSWKISLDVNHFSPEELNVKTKDGVLEITGKHEERKD 136

  Fly   114 EHGYVSRQFSRRYQLPSDVNPDTVTSSLSSDGLLTIKAPMKALPPP 159
            |||::||.|:|:|.||..|:.:.::|.||.:|:||::||   ||.|
Zfish   137 EHGFISRCFTRKYTLPPGVDSEKISSCLSPEGVLTVEAP---LPKP 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 34/81 (42%)
hspb1NP_001008615.2 ACD_HspB1_like 91..176 CDD:107230 36/87 (41%)
IbpA <94..191 CDD:223149 38/89 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101545
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.