DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and HSPB1

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_001531.1 Gene:HSPB1 / 3315 HGNCID:5246 Length:205 Species:Homo sapiens


Alignment Length:203 Identity:77/203 - (37%)
Similarity:105/203 - (51%) Gaps:43/203 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FRDWWDELDFPMRTSRLLDQHFGQGLKRDDLMSSVW---NSRPTVLRSGYLRPW----------- 58
            ||||:..       |||.||.|  ||.|.....|.|   :|.|     ||:||.           
Human    19 FRDWYPH-------SRLFDQAF--GLPRLPEEWSQWLGGSSWP-----GYVRPLPPAAIESPAVA 69

  Fly    59 ---HTNSLQKQESG--STLNIDSEKFEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYV 118
               ::.:|.:|.|.  |.:...::::.|.|||..|:|.|:|||..|..|.:.|||||:||||||:
Human    70 APAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYI 134

  Fly   119 SRQFSRRYQLPSDVNPDTVTSSLSSDGLLTIKAPMKALPPPQTERLVQIT------QTGPSSKED 177
            ||.|:|:|.||..|:|..|:||||.:|.||::|||..|.....|..:.:|      ..||.:   
Human   135 SRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEA--- 196

  Fly   178 NAKKVETS 185
             ||..||:
Human   197 -AKSDETA 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 41/81 (51%)
HSPB1NP_001531.1 Interaction with TGFB1I1. /evidence=ECO:0000250 70..205 56/138 (41%)
ACD_HspB1_like 84..169 CDD:107230 42/84 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101545
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.