DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and cryaba

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_571232.1 Gene:cryaba / 30393 ZFINID:ZDB-GENE-991119-2 Length:168 Species:Danio rerio


Alignment Length:141 Identity:59/141 - (41%)
Similarity:88/141 - (62%) Gaps:9/141 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 WWDELDFP-MRTSRLLDQHFGQGLKRDDLMSSVWNSRPTVLRSGYLRPWHTNSLQKQESG-STLN 73
            |:....|| ....|:.||:||:.|...|..|..:    |:.   |.||:........:|| |.:.
Zfish     9 WYRRPLFPGFFPYRIFDQYFGEHLSDSDPFSPFY----TMF---YYRPYLWRFPSWWDSGMSEMR 66

  Fly    74 IDSEKFEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYVSRQFSRRYQLPSDVNPDTVT 138
            .|.::|.:.|||:.|||.|:||||.:.|:.:.|||:|:||:||.|:|:|.|:|::|:.|:|..:|
Zfish    67 QDRDRFVINLDVKHFSPDELTVKVNEDFIEIHGKHDERQDDHGIVAREFFRKYKIPAGVDPGAIT 131

  Fly   139 SSLSSDGLLTI 149
            |||||||:|||
Zfish   132 SSLSSDGVLTI 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 41/79 (52%)
cryabaNP_571232.1 Crystallin 1..49 CDD:278926 13/46 (28%)
IbpA 11..142 CDD:223149 56/137 (41%)
alpha-crystallin-Hsps_p23-like 64..143 CDD:294116 41/79 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582878
Domainoid 1 1.000 102 1.000 Domainoid score I6798
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 118 1.000 Inparanoid score I4775
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 1 1.000 - - otm26160
orthoMCL 1 0.900 - - OOG6_101545
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X393
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.800

Return to query results.
Submit another query.