DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)efl and Hspb7

DIOPT Version :9

Sequence 1:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster
Sequence 2:NP_038896.2 Gene:Hspb7 / 29818 MGIID:1352494 Length:169 Species:Mus musculus


Alignment Length:104 Identity:37/104 - (35%)
Similarity:54/104 - (51%) Gaps:9/104 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 GSTLNIDS--EKFEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYVSRQFSRRYQLPSD 131
            |...||.:  :.:|..:|::.|||.:|.|...:..:.|..   ||....|.|...|:.:.|||.|
Mouse    69 GGQGNIKTLGDAYEFTVDMRDFSPEDIIVTTFNNHIEVRA---EKLAADGTVMNTFAHKCQLPED 130

  Fly   132 VNPDTVTSSLSSDGLLTIKAPMKALPPPQTERLVQITQT 170
            |:|.:|||:|..||.|||:|...    |.||.:.|..:|
Mouse   131 VDPTSVTSALREDGSLTIRARRH----PHTEHVQQTFRT 165

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 31/83 (37%)